Recombinant Human Interleukin-9 receptor (IL9R), partial, Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Interleukin-9 receptor (IL9R), partial, Biotinylated
• Artikelnummer: BYT-ORB3008846
• Hersteller Artikelnummer: orb3008846
• Alternativnummer: BYT-ORB3008846-1, BYT-ORB3008846-100, BYT-ORB3008846-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Interleukin-9 receptor, IL-9 receptor, IL-9R, CD antigen CD129, IL9R

Produktbeschreibung

This Recombinant Human Interleukin-9 receptor (IL9R), partial, Biotinylated spans the amino acid sequence from region 41-270. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: Q01113
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)