Recombinant Human Interleukin-9 receptor (IL9R), partial, Biotinylated

Catalog Number: BYT-ORB3008846
Article Name: Recombinant Human Interleukin-9 receptor (IL9R), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008846
Supplier Catalog Number: orb3008846
Alternative Catalog Number: BYT-ORB3008846-1, BYT-ORB3008846-100, BYT-ORB3008846-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin-9 receptor, IL-9 receptor, IL-9R, CD antigen CD129, IL9R
This Recombinant Human Interleukin-9 receptor (IL9R), partial, Biotinylated spans the amino acid sequence from region 41-270. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01113
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP
Application Notes: Biological Origin: Homo sapiens (Human)