Recombinant Human Insulinoma-associated protein 1 (INSM1), Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Insulinoma-associated protein 1 (INSM1), Biotinylated
• Artikelnummer: BYT-ORB3008848
• Hersteller Artikelnummer: orb3008848
• Alternativnummer: BYT-ORB3008848-1, BYT-ORB3008848-100, BYT-ORB3008848-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Insulinoma-associated protein 1, Zinc finger protein IA-1, INSM1 IA1

Produktbeschreibung

This Recombinant Human Insulinoma-associated protein 1 (INSM1), Biotinylated spans the amino acid sequence from region 1-510. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: Q01101
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MPRGFLVKRSKKSTPVSYRVRGGEDGDRALLLSPSCGGARAEPPAPSPVPGPLPPPPPAERAHAALAAALACAPGPQPPPQGPRAAHFGNPEAAHPAPLYSPTRPVSREHEKHKYFERSFNLGSPVSAESFPTPAALLGGGGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAARGPGPGPPLPPAAALRPPGKRPPPPTAAEPPAKAVKAPGAKKPKAIRKLHFEDEVTTSPVLGLKIKEGPVEAPRG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)