Recombinant Human Insulinoma-associated protein 1 (INSM1), Biotinylated

Catalog Number: BYT-ORB3008848
Article Name: Recombinant Human Insulinoma-associated protein 1 (INSM1), Biotinylated
Biozol Catalog Number: BYT-ORB3008848
Supplier Catalog Number: orb3008848
Alternative Catalog Number: BYT-ORB3008848-1, BYT-ORB3008848-100, BYT-ORB3008848-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Insulinoma-associated protein 1, Zinc finger protein IA-1, INSM1 IA1
This Recombinant Human Insulinoma-associated protein 1 (INSM1), Biotinylated spans the amino acid sequence from region 1-510. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01101
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPRGFLVKRSKKSTPVSYRVRGGEDGDRALLLSPSCGGARAEPPAPSPVPGPLPPPPPAERAHAALAAALACAPGPQPPPQGPRAAHFGNPEAAHPAPLYSPTRPVSREHEKHKYFERSFNLGSPVSAESFPTPAALLGGGGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAARGPGPGPPLPPAAALRPPGKRPPPPTAAEPPAKAVKAPGAKKPKAIRKLHFEDEVTTSPVLGLKIKEGPVEAPRG
Application Notes: Biological Origin: Homo sapiens (Human)