Recombinant Human Spectrin beta chain, non-erythrocytic 1 (SPTB2), partial, Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Spectrin beta chain, non-erythrocytic 1 (SPTB2), partial, Biotinylated
• Artikelnummer: BYT-ORB3008850
• Hersteller Artikelnummer: orb3008850
• Alternativnummer: BYT-ORB3008850-1, BYT-ORB3008850-100, BYT-ORB3008850-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Spectrin beta chain, non-erythrocytic 1, Beta-II spectrin, Fodrin beta chain, Spectrin, non-erythroid beta chain 1, SPTBN1 SPTB2

Produktbeschreibung

This Recombinant Human Spectrin beta chain, non-erythrocytic 1 (SPTB2), partial, Biotinylated spans the amino acid sequence from region 2197-2307. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: Q01082
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAIS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)