Recombinant Human Spectrin beta chain, non-erythrocytic 1 (SPTB2), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human Spectrin beta chain, non-erythrocytic 1 (SPTB2), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008850
• Supplier Catalog Number: orb3008850
• Alternative Catalog Number: BYT-ORB3008850-1, BYT-ORB3008850-100, BYT-ORB3008850-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Spectrin beta chain, non-erythrocytic 1, Beta-II spectrin, Fodrin beta chain, Spectrin, non-erythroid beta chain 1, SPTBN1 SPTB2

Product Description

This Recombinant Human Spectrin beta chain, non-erythrocytic 1 (SPTB2), partial, Biotinylated spans the amino acid sequence from region 2197-2307. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q01082
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: SAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAIS

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)