Recombinant Human Photoreceptor disk component PRCD (PRCD), Biotinylated

Artikelnummer: BYT-ORB3008852
Artikelname: Recombinant Human Photoreceptor disk component PRCD (PRCD), Biotinylated
Artikelnummer: BYT-ORB3008852
Hersteller Artikelnummer: orb3008852
Alternativnummer: BYT-ORB3008852-1, BYT-ORB3008852-100, BYT-ORB3008852-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Photoreceptor disk component PRCD, Progressive rod-cone degeneration protein, PRCD
This Recombinant Human Photoreceptor disk component PRCD (PRCD), Biotinylated spans the amino acid sequence from region 1-54. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q00LT1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)