Recombinant Human Photoreceptor disk component PRCD (PRCD), Biotinylated

Catalog Number: BYT-ORB3008852
Article Name: Recombinant Human Photoreceptor disk component PRCD (PRCD), Biotinylated
Biozol Catalog Number: BYT-ORB3008852
Supplier Catalog Number: orb3008852
Alternative Catalog Number: BYT-ORB3008852-1, BYT-ORB3008852-100, BYT-ORB3008852-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Photoreceptor disk component PRCD, Progressive rod-cone degeneration protein, PRCD
This Recombinant Human Photoreceptor disk component PRCD (PRCD), Biotinylated spans the amino acid sequence from region 1-54. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q00LT1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK
Application Notes: Biological Origin: Homo sapiens (Human)