Recombinant Human Voltage-dependent N-type calcium channel subunit alpha-1B (CAC1B), partial, Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Voltage-dependent N-type calcium channel subunit alpha-1B (CAC1B), partial, Biotinylated
• Artikelnummer: BYT-ORB3008856
• Hersteller Artikelnummer: orb3008856
• Alternativnummer: BYT-ORB3008856-1, BYT-ORB3008856-100, BYT-ORB3008856-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Voltage-dependent N-type calcium channel subunit alpha-1B, Brain calcium channel III, BIII, Calcium channel, L type, alpha-1 polypeptide isoform 5, Voltage-gated calcium channel subunit alpha Cav2.2, CACNA1B CACH5 CACNL1A5

Produktbeschreibung

This Recombinant Human Voltage-dependent N-type calcium channel subunit alpha-1B (CAC1B), partial, Biotinylated spans the amino acid sequence from region 245-331. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: Q00975
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YMGKFHKACFPNSTDAEPVGDFPCGKEAPARLCEGDTECREYWPGPNFGITNFDNILFAILTVFQCITMEGWTDILYNTNDAAGNTW

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)