Recombinant Human Voltage-dependent N-type calcium channel subunit alpha-1B (CAC1B), partial, Biotinylated

Catalog Number: BYT-ORB3008856
Article Name: Recombinant Human Voltage-dependent N-type calcium channel subunit alpha-1B (CAC1B), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008856
Supplier Catalog Number: orb3008856
Alternative Catalog Number: BYT-ORB3008856-1, BYT-ORB3008856-100, BYT-ORB3008856-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Voltage-dependent N-type calcium channel subunit alpha-1B, Brain calcium channel III, BIII, Calcium channel, L type, alpha-1 polypeptide isoform 5, Voltage-gated calcium channel subunit alpha Cav2.2, CACNA1B CACH5 CACNL1A5
This Recombinant Human Voltage-dependent N-type calcium channel subunit alpha-1B (CAC1B), partial, Biotinylated spans the amino acid sequence from region 245-331. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q00975
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YMGKFHKACFPNSTDAEPVGDFPCGKEAPARLCEGDTECREYWPGPNFGITNFDNILFAILTVFQCITMEGWTDILYNTNDAAGNTW
Application Notes: Biological Origin: Homo sapiens (Human)