Recombinant Human Beta-1,4 N-acetylgalactosaminyltransferase 1 (B4GN1), partial, Biotinylated

Artikelnummer: BYT-ORB3008857
Artikelname: Recombinant Human Beta-1,4 N-acetylgalactosaminyltransferase 1 (B4GN1), partial, Biotinylated
Artikelnummer: BYT-ORB3008857
Hersteller Artikelnummer: orb3008857
Alternativnummer: BYT-ORB3008857-1, BYT-ORB3008857-100, BYT-ORB3008857-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Beta-1,4 N-acetylgalactosaminyltransferase 1, EC 2.4.1.92, (N-acetylneuraminyl-galactosylglucosylceramide, GM2/GD2 synthase, GalNAc-T, B4GALNT1 GALGT SIAT2
This Recombinant Human Beta-1,4 N-acetylgalactosaminyltransferase 1 (B4GN1), partial, Biotinylated spans the amino acid sequence from region 26-533. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q00973
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: STRDAPGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVT
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)