Recombinant Human Beta-1,4 N-acetylgalactosaminyltransferase 1 (B4GN1), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human Beta-1,4 N-acetylgalactosaminyltransferase 1 (B4GN1), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008857
• Supplier Catalog Number: orb3008857
• Alternative Catalog Number: BYT-ORB3008857-1, BYT-ORB3008857-100, BYT-ORB3008857-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Beta-1,4 N-acetylgalactosaminyltransferase 1, EC 2.4.1.92, (N-acetylneuraminyl-galactosylglucosylceramide, GM2/GD2 synthase, GalNAc-T, B4GALNT1 GALGT SIAT2

Product Description

This Recombinant Human Beta-1,4 N-acetylgalactosaminyltransferase 1 (B4GN1), partial, Biotinylated spans the amino acid sequence from region 26-533. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q00973
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: STRDAPGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVT

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)