Recombinant Human Pregnancy-specific beta-1-glycoprotein 4 (PSG4), Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Pregnancy-specific beta-1-glycoprotein 4 (PSG4), Biotinylated
• Artikelnummer: BYT-ORB3008858
• Hersteller Artikelnummer: orb3008858
• Alternativnummer: BYT-ORB3008858-1, BYT-ORB3008858-100, BYT-ORB3008858-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Pregnancy-specific beta-1-glycoprotein 4, PS-beta-G-4, PSBG-4, Pregnancy-specific glycoprotein 4, Pregnancy-specific beta-1-glycoprotein 9, PS-beta-G-9, PSBG-9, Pregnancy-specific glycoprotein 9, PSG4 CGM4 PSG9

Produktbeschreibung

This Recombinant Human Pregnancy-specific beta-1-glycoprotein 4 (PSG4), Biotinylated spans the amino acid sequence from region 35-419. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: Q00888
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QVTIEAQPPKVSEGKDVLLLVHNLPQNLAGYIWYKGQMTYLYHYITSYVVDGQRIIYGPAYSGRERVYSNASLLIQNVTQEDAGSYTLHIIKRRDGTGGVTGHFTFTLHLETPKPSISSSNLNPREAMEAVILTCDPATPAASYQWWMNGQSLPMTHRLQLSKTNRTLFIFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLSKPYITINNLNPRENKDVLTFTCEPKSKNYTYIWWLNGQSLPVSPRVKRP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)