Recombinant Human Pregnancy-specific beta-1-glycoprotein 4 (PSG4), Biotinylated

Product Overview

• Article Name: Recombinant Human Pregnancy-specific beta-1-glycoprotein 4 (PSG4), Biotinylated
• Biozol Catalog Number: BYT-ORB3008858
• Supplier Catalog Number: orb3008858
• Alternative Catalog Number: BYT-ORB3008858-1, BYT-ORB3008858-100, BYT-ORB3008858-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Pregnancy-specific beta-1-glycoprotein 4, PS-beta-G-4, PSBG-4, Pregnancy-specific glycoprotein 4, Pregnancy-specific beta-1-glycoprotein 9, PS-beta-G-9, PSBG-9, Pregnancy-specific glycoprotein 9, PSG4 CGM4 PSG9

Product Description

This Recombinant Human Pregnancy-specific beta-1-glycoprotein 4 (PSG4), Biotinylated spans the amino acid sequence from region 35-419. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q00888
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: QVTIEAQPPKVSEGKDVLLLVHNLPQNLAGYIWYKGQMTYLYHYITSYVVDGQRIIYGPAYSGRERVYSNASLLIQNVTQEDAGSYTLHIIKRRDGTGGVTGHFTFTLHLETPKPSISSSNLNPREAMEAVILTCDPATPAASYQWWMNGQSLPMTHRLQLSKTNRTLFIFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLSKPYITINNLNPRENKDVLTFTCEPKSKNYTYIWWLNGQSLPVSPRVKRP

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)