Recombinant Human Myosin-binding protein C, slow-type (MYPC1), partial, Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Myosin-binding protein C, slow-type (MYPC1), partial, Biotinylated
• Artikelnummer: BYT-ORB3008860
• Hersteller Artikelnummer: orb3008860
• Alternativnummer: BYT-ORB3008860-1, BYT-ORB3008860-100, BYT-ORB3008860-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Myosin-binding protein C, slow-type, Slow MyBP-C, C-protein, skeletal muscle slow isoform, MYBPC1 MYBPCS

Produktbeschreibung

This Recombinant Human Myosin-binding protein C, slow-type (MYPC1), partial, Biotinylated spans the amino acid sequence from region 722-833. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: Q00872
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: TLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)