Recombinant Human Myosin-binding protein C, slow-type (MYPC1), partial, Biotinylated

Catalog Number: BYT-ORB3008860
Article Name: Recombinant Human Myosin-binding protein C, slow-type (MYPC1), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008860
Supplier Catalog Number: orb3008860
Alternative Catalog Number: BYT-ORB3008860-1, BYT-ORB3008860-100, BYT-ORB3008860-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Myosin-binding protein C, slow-type, Slow MyBP-C, C-protein, skeletal muscle slow isoform, MYBPC1 MYBPCS
This Recombinant Human Myosin-binding protein C, slow-type (MYPC1), partial, Biotinylated spans the amino acid sequence from region 722-833. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q00872
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI
Application Notes: Biological Origin: Homo sapiens (Human)