Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial, Biotinylated

Artikelnummer: BYT-ORB3008862
Artikelname: Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial, Biotinylated
Artikelnummer: BYT-ORB3008862
Hersteller Artikelnummer: orb3008862
Alternativnummer: BYT-ORB3008862-1, BYT-ORB3008862-100, BYT-ORB3008862-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Receptor expression-enhancing protein 5, Polyposis locus protein 1, Protein TB2, REEP5 C5orf18 DP1 TB2
This Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial, Biotinylated spans the amino acid sequence from region 124-189. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q00765
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: CMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)