Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial, Biotinylated

Catalog Number: BYT-ORB3008862
Article Name: Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008862
Supplier Catalog Number: orb3008862
Alternative Catalog Number: BYT-ORB3008862-1, BYT-ORB3008862-100, BYT-ORB3008862-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Receptor expression-enhancing protein 5, Polyposis locus protein 1, Protein TB2, REEP5 C5orf18 DP1 TB2
This Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial, Biotinylated spans the amino acid sequence from region 124-189. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q00765
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: CMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST
Application Notes: Biological Origin: Homo sapiens (Human)