Recombinant Human Clathrin heavy chain 1 (CLH1), partial, Biotinylated

Artikelnummer: BYT-ORB3008866
Artikelname: Recombinant Human Clathrin heavy chain 1 (CLH1), partial, Biotinylated
Artikelnummer: BYT-ORB3008866
Hersteller Artikelnummer: orb3008866
Alternativnummer: BYT-ORB3008866-1, BYT-ORB3008866-100, BYT-ORB3008866-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Clathrin heavy chain 1, Clathrin heavy chain on chromosome 17, CLH-17, CLTC CLH17 CLTCL2 KIAA0034
This Recombinant Human Clathrin heavy chain 1 (CLH1), partial, Biotinylated spans the amino acid sequence from region 1-364. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q00610
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)