Recombinant Human Clathrin heavy chain 1 (CLH1), partial, Biotinylated

Catalog Number: BYT-ORB3008866
Article Name: Recombinant Human Clathrin heavy chain 1 (CLH1), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008866
Supplier Catalog Number: orb3008866
Alternative Catalog Number: BYT-ORB3008866-1, BYT-ORB3008866-100, BYT-ORB3008866-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Clathrin heavy chain 1, Clathrin heavy chain on chromosome 17, CLH-17, CLTC CLH17 CLTCL2 KIAA0034
This Recombinant Human Clathrin heavy chain 1 (CLH1), partial, Biotinylated spans the amino acid sequence from region 1-364. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q00610
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPE
Application Notes: Biological Origin: Homo sapiens (Human)