Recombinant Human Cyclin-dependent kinase 6 (CDK6), Biotinylated

Artikelnummer: BYT-ORB3008868
Artikelname: Recombinant Human Cyclin-dependent kinase 6 (CDK6), Biotinylated
Artikelnummer: BYT-ORB3008868
Hersteller Artikelnummer: orb3008868
Alternativnummer: BYT-ORB3008868-1, BYT-ORB3008868-100, BYT-ORB3008868-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cyclin-dependent kinase 6, EC 2.7.11.22, Cell division protein kinase 6, Serine/threonine-protein kinase PLSTIRE, CDK6 CDKN6
This Recombinant Human Cyclin-dependent kinase 6 (CDK6), Biotinylated spans the amino acid sequence from region 1-326. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q00534
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFH
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)