Recombinant Human Cyclin-dependent kinase 6 (CDK6), Biotinylated

Product Overview

• Article Name: Recombinant Human Cyclin-dependent kinase 6 (CDK6), Biotinylated
• Biozol Catalog Number: BYT-ORB3008868
• Supplier Catalog Number: orb3008868
• Alternative Catalog Number: BYT-ORB3008868-1, BYT-ORB3008868-100, BYT-ORB3008868-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Cyclin-dependent kinase 6, EC 2.7.11.22, Cell division protein kinase 6, Serine/threonine-protein kinase PLSTIRE, CDK6 CDKN6

Product Description

This Recombinant Human Cyclin-dependent kinase 6 (CDK6), Biotinylated spans the amino acid sequence from region 1-326. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q00534
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFH

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)