Recombinant Human Homeobox protein Hox-C5 (HXC5), Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Homeobox protein Hox-C5 (HXC5), Biotinylated
• Artikelnummer: BYT-ORB3008871
• Hersteller Artikelnummer: orb3008871
• Alternativnummer: BYT-ORB3008871-1, BYT-ORB3008871-100, BYT-ORB3008871-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Homeobox protein Hox-C5, Homeobox protein CP11, Homeobox protein Hox-3D, HOXC5 HOX3D

Produktbeschreibung

This Recombinant Human Homeobox protein Hox-C5 (HXC5), Biotinylated spans the amino acid sequence from region 1-222. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: Q00444
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPRAHPDRPACSAAAAPGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEAL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)