Recombinant Human Homeobox protein Hox-C5 (HXC5), Biotinylated

Catalog Number: BYT-ORB3008871
Article Name: Recombinant Human Homeobox protein Hox-C5 (HXC5), Biotinylated
Biozol Catalog Number: BYT-ORB3008871
Supplier Catalog Number: orb3008871
Alternative Catalog Number: BYT-ORB3008871-1, BYT-ORB3008871-100, BYT-ORB3008871-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Homeobox protein Hox-C5, Homeobox protein CP11, Homeobox protein Hox-3D, HOXC5 HOX3D
This Recombinant Human Homeobox protein Hox-C5 (HXC5), Biotinylated spans the amino acid sequence from region 1-222. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q00444
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPRAHPDRPACSAAAAPGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEAL
Application Notes: Biological Origin: Homo sapiens (Human)