Recombinant Human Solute carrier family 25 member 3 (S25A3), partial, Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Solute carrier family 25 member 3 (S25A3), partial, Biotinylated
• Artikelnummer: BYT-ORB3008872
• Hersteller Artikelnummer: orb3008872
• Alternativnummer: BYT-ORB3008872-1, BYT-ORB3008872-100, BYT-ORB3008872-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Solute carrier family 25 member 3, Phosphate carrier protein, mitochondrial, Phosphate transport protein, PTP, SLC25A3 PHC OK/SW-cl.48

Produktbeschreibung

This Recombinant Human Solute carrier family 25 member 3 (S25A3), partial, Biotinylated spans the amino acid sequence from region 87-121. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: Q00325
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)