Recombinant Human Solute carrier family 25 member 3 (S25A3), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human Solute carrier family 25 member 3 (S25A3), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008872
• Supplier Catalog Number: orb3008872
• Alternative Catalog Number: BYT-ORB3008872-1, BYT-ORB3008872-100, BYT-ORB3008872-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Solute carrier family 25 member 3, Phosphate carrier protein, mitochondrial, Phosphate transport protein, PTP, SLC25A3 PHC OK/SW-cl.48

Product Description

This Recombinant Human Solute carrier family 25 member 3 (S25A3), partial, Biotinylated spans the amino acid sequence from region 87-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q00325
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: DLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAK

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)