Recombinant Human Mucin-5AC (MUC5A), partial, Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Mucin-5AC (MUC5A), partial, Biotinylated
• Artikelnummer: BYT-ORB3008873
• Hersteller Artikelnummer: orb3008873
• Alternativnummer: BYT-ORB3008873-1, BYT-ORB3008873-100, BYT-ORB3008873-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Mucin-5AC, MUC-5AC, Gastric mucin, Major airway glycoprotein, Mucin-5 subtype AC, tracheobronchial, Tracheobronchial mucin, TBM, MUC5AC MUC5

Produktbeschreibung

This Recombinant Human Mucin-5AC (MUC5A), partial, Biotinylated spans the amino acid sequence from region 4919-5103. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: P98088
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: CVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIVPVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATIPELGVQVMFSGLIFSVEVPFSKFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACH

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)