Recombinant Human Mucin-5AC (MUC5A), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human Mucin-5AC (MUC5A), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008873
• Supplier Catalog Number: orb3008873
• Alternative Catalog Number: BYT-ORB3008873-1, BYT-ORB3008873-100, BYT-ORB3008873-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Mucin-5AC, MUC-5AC, Gastric mucin, Major airway glycoprotein, Mucin-5 subtype AC, tracheobronchial, Tracheobronchial mucin, TBM, MUC5AC MUC5

Product Description

This Recombinant Human Mucin-5AC (MUC5A), partial, Biotinylated spans the amino acid sequence from region 4919-5103. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P98088
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: CVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIVPVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATIPELGVQVMFSGLIFSVEVPFSKFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACH

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)