Recombinant Human 5-AMP-activated protein kinase subunit gamma-1 (AAKG1), Biotinylated

Produktübersicht

• Artikelname: Recombinant Human 5-AMP-activated protein kinase subunit gamma-1 (AAKG1), Biotinylated
• Artikelnummer: BYT-ORB3008878
• Hersteller Artikelnummer: orb3008878
• Alternativnummer: BYT-ORB3008878-1, BYT-ORB3008878-100, BYT-ORB3008878-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: 5-AMP-activated protein kinase subunit gamma-1, AMPK gamma1, AMPK subunit gamma-1, AMPKg, PRKAG1

Produktbeschreibung

This Recombinant Human 5-AMP-activated protein kinase subunit gamma-1 (AAKG1), Biotinylated spans the amino acid sequence from region 1-331. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: P54619
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTY

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)