Recombinant Human 5-AMP-activated protein kinase subunit gamma-1 (AAKG1), Biotinylated

Catalog Number: BYT-ORB3008878
Article Name: Recombinant Human 5-AMP-activated protein kinase subunit gamma-1 (AAKG1), Biotinylated
Biozol Catalog Number: BYT-ORB3008878
Supplier Catalog Number: orb3008878
Alternative Catalog Number: BYT-ORB3008878-1, BYT-ORB3008878-100, BYT-ORB3008878-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 5-AMP-activated protein kinase subunit gamma-1, AMPK gamma1, AMPK subunit gamma-1, AMPKg, PRKAG1
This Recombinant Human 5-AMP-activated protein kinase subunit gamma-1 (AAKG1), Biotinylated spans the amino acid sequence from region 1-331. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P54619
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTY
Application Notes: Biological Origin: Homo sapiens (Human)