Recombinant Human Coatomer subunit beta (COPB2), partial, Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Coatomer subunit beta (COPB2), partial, Biotinylated
• Artikelnummer: BYT-ORB3008885
• Hersteller Artikelnummer: orb3008885
• Alternativnummer: BYT-ORB3008885-1, BYT-ORB3008885-100, BYT-ORB3008885-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Coatomer subunit beta, Beta-coat protein, Beta-COP, p102, COPB2

Produktbeschreibung

This Recombinant Human Coatomer subunit beta (COPB2), partial, Biotinylated spans the amino acid sequence from region 1-597. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: P35606
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MPLRLDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPVRAAKFVARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDDMLIKLWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQFASASLDRTIKVWQLGSSSPNFTLEGHEKGVNCIDYYSGGDKPYLISGADDRLVKIWDYQNKTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)