Recombinant Human Coatomer subunit beta (COPB2), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human Coatomer subunit beta (COPB2), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008885
• Supplier Catalog Number: orb3008885
• Alternative Catalog Number: BYT-ORB3008885-1, BYT-ORB3008885-100, BYT-ORB3008885-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Coatomer subunit beta, Beta-coat protein, Beta-COP, p102, COPB2

Product Description

This Recombinant Human Coatomer subunit beta (COPB2), partial, Biotinylated spans the amino acid sequence from region 1-597. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P35606
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MPLRLDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPVRAAKFVARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDDMLIKLWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQFASASLDRTIKVWQLGSSSPNFTLEGHEKGVNCIDYYSGGDKPYLISGADDRLVKIWDYQNKTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRI

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)