Recombinant Human 2-5-oligoadenylate synthase 2 (OAS2), Biotinylated

Artikelnummer: BYT-ORB3008887
Artikelname: Recombinant Human 2-5-oligoadenylate synthase 2 (OAS2), Biotinylated
Artikelnummer: BYT-ORB3008887
Hersteller Artikelnummer: orb3008887
Alternativnummer: BYT-ORB3008887-1, BYT-ORB3008887-100, BYT-ORB3008887-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 2-5-oligoadenylate synthase 2, (2-5oligo(A, synthase 2, 2-5A synthase 2, EC 2.7.7.84, p69 OAS / p71 OAS, p69OAS / p71OAS, OAS2
This Recombinant Human 2-5-oligoadenylate synthase 2 (OAS2), Biotinylated spans the amino acid sequence from region 2-719. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P29728
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GNGESQLSSVPAQKLGWFIQEYLKPYEECQTLIDEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEIQKSLDGFTIQVFTKNQRISFEVLAAFNALSLNDNPSPWIYRELKRSLDKTNASPGEFAVCFTELQQKFFDNRPGKLKDLILLIKHWHQQCQKKIKDLPSLSPYALELLTVYAWEQGCRKDNFDIAEGVRTVLELIK
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)