Recombinant Human 2-5-oligoadenylate synthase 2 (OAS2), Biotinylated

Product Overview

• Article Name: Recombinant Human 2-5-oligoadenylate synthase 2 (OAS2), Biotinylated
• Biozol Catalog Number: BYT-ORB3008887
• Supplier Catalog Number: orb3008887
• Alternative Catalog Number: BYT-ORB3008887-1, BYT-ORB3008887-100, BYT-ORB3008887-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: 2-5-oligoadenylate synthase 2, (2-5oligo(A, synthase 2, 2-5A synthase 2, EC 2.7.7.84, p69 OAS / p71 OAS, p69OAS / p71OAS, OAS2

Product Description

This Recombinant Human 2-5-oligoadenylate synthase 2 (OAS2), Biotinylated spans the amino acid sequence from region 2-719. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P29728
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: GNGESQLSSVPAQKLGWFIQEYLKPYEECQTLIDEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEIQKSLDGFTIQVFTKNQRISFEVLAAFNALSLNDNPSPWIYRELKRSLDKTNASPGEFAVCFTELQQKFFDNRPGKLKDLILLIKHWHQQCQKKIKDLPSLSPYALELLTVYAWEQGCRKDNFDIAEGVRTVLELIK

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)