Recombinant Human Serpin B3 (SPB3), Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Serpin B3 (SPB3), Biotinylated
• Artikelnummer: BYT-ORB3008888
• Hersteller Artikelnummer: orb3008888
• Alternativnummer: BYT-ORB3008888-1, BYT-ORB3008888-100, BYT-ORB3008888-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Serpin B3, Protein T4-A, Squamous cell carcinoma antigen 1, SCCA-1, SERPINB3 SCCA SCCA1

Produktbeschreibung

This Recombinant Human Serpin B3 (SPB3), Biotinylated spans the amino acid sequence from region 1-390. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: P29508
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQ

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)