Recombinant Human Serpin B3 (SPB3), Biotinylated

Catalog Number: BYT-ORB3008888
Article Name: Recombinant Human Serpin B3 (SPB3), Biotinylated
Biozol Catalog Number: BYT-ORB3008888
Supplier Catalog Number: orb3008888
Alternative Catalog Number: BYT-ORB3008888-1, BYT-ORB3008888-100, BYT-ORB3008888-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Serpin B3, Protein T4-A, Squamous cell carcinoma antigen 1, SCCA-1, SERPINB3 SCCA SCCA1
This Recombinant Human Serpin B3 (SPB3), Biotinylated spans the amino acid sequence from region 1-390. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P29508
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQ
Application Notes: Biological Origin: Homo sapiens (Human)