Recombinant Human 3,5-cyclic-AMP phosphodiesterase 4A (PDE4A), partial, Biotinylated

Artikelnummer: BYT-ORB3008889
Artikelname: Recombinant Human 3,5-cyclic-AMP phosphodiesterase 4A (PDE4A), partial, Biotinylated
Artikelnummer: BYT-ORB3008889
Hersteller Artikelnummer: orb3008889
Alternativnummer: BYT-ORB3008889-1, BYT-ORB3008889-100, BYT-ORB3008889-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 3,5-cyclic-AMP phosphodiesterase 4A, EC 3.1.4.53, DPDE2, PDE46, cAMP-specific phosphodiesterase 4A, PDE4A DPDE2
This Recombinant Human 3,5-cyclic-AMP phosphodiesterase 4A (PDE4A), partial, Biotinylated spans the amino acid sequence from region 357-686. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P27815
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VKTDQEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYMLTLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLELYRQWTDRIMA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)