Recombinant Human 3,5-cyclic-AMP phosphodiesterase 4A (PDE4A), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human 3,5-cyclic-AMP phosphodiesterase 4A (PDE4A), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008889
• Supplier Catalog Number: orb3008889
• Alternative Catalog Number: BYT-ORB3008889-1, BYT-ORB3008889-100, BYT-ORB3008889-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: 3,5-cyclic-AMP phosphodiesterase 4A, EC 3.1.4.53, DPDE2, PDE46, cAMP-specific phosphodiesterase 4A, PDE4A DPDE2

Product Description

This Recombinant Human 3,5-cyclic-AMP phosphodiesterase 4A (PDE4A), partial, Biotinylated spans the amino acid sequence from region 357-686. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P27815
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: VKTDQEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYMLTLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLELYRQWTDRIMA

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)