Recombinant Human Deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial (DUT), Biotinylated

Artikelnummer: BYT-ORB3008891
Artikelname: Recombinant Human Deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial (DUT), Biotinylated
Artikelnummer: BYT-ORB3008891
Hersteller Artikelnummer: orb3008891
Alternativnummer: BYT-ORB3008891-1, BYT-ORB3008891-100, BYT-ORB3008891-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial, dUTPase, EC 3.6.1.23, dUTP pyrophosphatase, DUT
This Recombinant Human Deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial (DUT), Biotinylated spans the amino acid sequence from region 70-252. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P33316
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)