Recombinant Human Deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial (DUT), Biotinylated

Catalog Number: BYT-ORB3008891
Article Name: Recombinant Human Deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial (DUT), Biotinylated
Biozol Catalog Number: BYT-ORB3008891
Supplier Catalog Number: orb3008891
Alternative Catalog Number: BYT-ORB3008891-1, BYT-ORB3008891-100, BYT-ORB3008891-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial, dUTPase, EC 3.6.1.23, dUTP pyrophosphatase, DUT
This Recombinant Human Deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial (DUT), Biotinylated spans the amino acid sequence from region 70-252. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P33316
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Application Notes: Biological Origin: Homo sapiens (Human)