Recombinant Human Azurocidin (CAP7), Biotinylated

Artikelnummer: BYT-ORB3008894
Artikelname: Recombinant Human Azurocidin (CAP7), Biotinylated
Artikelnummer: BYT-ORB3008894
Hersteller Artikelnummer: orb3008894
Alternativnummer: BYT-ORB3008894-1, BYT-ORB3008894-100, BYT-ORB3008894-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Azurocidin, Cationic antimicrobial protein CAP37, Heparin-binding protein, HBP, hHBP, AZU1
This Recombinant Human Azurocidin (CAP7), Biotinylated spans the amino acid sequence from region 27-248. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P20160
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGP
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)