Recombinant Human Azurocidin (CAP7), Biotinylated

Catalog Number: BYT-ORB3008894
Article Name: Recombinant Human Azurocidin (CAP7), Biotinylated
Biozol Catalog Number: BYT-ORB3008894
Supplier Catalog Number: orb3008894
Alternative Catalog Number: BYT-ORB3008894-1, BYT-ORB3008894-100, BYT-ORB3008894-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Azurocidin, Cationic antimicrobial protein CAP37, Heparin-binding protein, HBP, hHBP, AZU1
This Recombinant Human Azurocidin (CAP7), Biotinylated spans the amino acid sequence from region 27-248. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P20160
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGP
Application Notes: Biological Origin: Homo sapiens (Human)