Recombinant Human Retinal rod rhodopsin-sensitive cGMP 3,5-cyclic phosphodiesterase subunit gamma (CNRG), Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Retinal rod rhodopsin-sensitive cGMP 3,5-cyclic phosphodiesterase subunit gamma (CNRG), Biotinylated
• Artikelnummer: BYT-ORB3008897
• Hersteller Artikelnummer: orb3008897
• Alternativnummer: BYT-ORB3008897-1, BYT-ORB3008897-100, BYT-ORB3008897-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Retinal rod rhodopsin-sensitive cGMP 3,5-cyclic phosphodiesterase subunit gamma, GMP-PDE gamma, EC 3.1.4.35, PDE6G PDEG

Produktbeschreibung

This Recombinant Human Retinal rod rhodopsin-sensitive cGMP 3,5-cyclic phosphodiesterase subunit gamma (CNRG), Biotinylated spans the amino acid sequence from region 1-87. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: P18545
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)