Recombinant Human Retinal rod rhodopsin-sensitive cGMP 3,5-cyclic phosphodiesterase subunit gamma (CNRG), Biotinylated

Catalog Number: BYT-ORB3008897
Article Name: Recombinant Human Retinal rod rhodopsin-sensitive cGMP 3,5-cyclic phosphodiesterase subunit gamma (CNRG), Biotinylated
Biozol Catalog Number: BYT-ORB3008897
Supplier Catalog Number: orb3008897
Alternative Catalog Number: BYT-ORB3008897-1, BYT-ORB3008897-100, BYT-ORB3008897-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Retinal rod rhodopsin-sensitive cGMP 3,5-cyclic phosphodiesterase subunit gamma, GMP-PDE gamma, EC 3.1.4.35, PDE6G PDEG
This Recombinant Human Retinal rod rhodopsin-sensitive cGMP 3,5-cyclic phosphodiesterase subunit gamma (CNRG), Biotinylated spans the amino acid sequence from region 1-87. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P18545
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII
Application Notes: Biological Origin: Homo sapiens (Human)