Recombinant Human Aspartate aminotransferase, cytoplasmic (AATC), Biotinylated

Artikelnummer: BYT-ORB3008898
Artikelname: Recombinant Human Aspartate aminotransferase, cytoplasmic (AATC), Biotinylated
Artikelnummer: BYT-ORB3008898
Hersteller Artikelnummer: orb3008898
Alternativnummer: BYT-ORB3008898-1, BYT-ORB3008898-100, BYT-ORB3008898-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Aspartate aminotransferase, cytoplasmic, cAspAT, EC 2.6.1.1, EC 2.6.1.3, Cysteine aminotransferase, cytoplasmic, Cysteine transaminase, cytoplasmic, cCAT, Glutamate oxaloacetate transaminase 1, Transaminase A, GOT1
This Recombinant Human Aspartate aminotransferase, cytoplasmic (AATC), Biotinylated spans the amino acid sequence from region 2-413. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P17174
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: APPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)