Recombinant Human Aspartate aminotransferase, cytoplasmic (AATC), Biotinylated

Catalog Number: BYT-ORB3008898
Article Name: Recombinant Human Aspartate aminotransferase, cytoplasmic (AATC), Biotinylated
Biozol Catalog Number: BYT-ORB3008898
Supplier Catalog Number: orb3008898
Alternative Catalog Number: BYT-ORB3008898-1, BYT-ORB3008898-100, BYT-ORB3008898-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Aspartate aminotransferase, cytoplasmic, cAspAT, EC 2.6.1.1, EC 2.6.1.3, Cysteine aminotransferase, cytoplasmic, Cysteine transaminase, cytoplasmic, cCAT, Glutamate oxaloacetate transaminase 1, Transaminase A, GOT1
This Recombinant Human Aspartate aminotransferase, cytoplasmic (AATC), Biotinylated spans the amino acid sequence from region 2-413. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P17174
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: APPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQS
Application Notes: Biological Origin: Homo sapiens (Human)