Recombinant Human T-cell surface glycoprotein CD1e, membrane-associated (CD1E), partial, Biotinylated

Produktübersicht

• Artikelname: Recombinant Human T-cell surface glycoprotein CD1e, membrane-associated (CD1E), partial, Biotinylated
• Artikelnummer: BYT-ORB3008900
• Hersteller Artikelnummer: orb3008900
• Alternativnummer: BYT-ORB3008900-1, BYT-ORB3008900-100, BYT-ORB3008900-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: T-cell surface glycoprotein CD1e, membrane-associated, hCD1e, R2G1, CD antigen CD1e, [Cleaved into: T-cell surface glycoprotein CD1e, soluble, sCD1e] CD1E

Produktbeschreibung

This Recombinant Human T-cell surface glycoprotein CD1e, membrane-associated (CD1E), partial, Biotinylated spans the amino acid sequence from region 32-304. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: P15812
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: EEQLSFRMLQTSSFANHSWAHSEGSGWLGDLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNMAYQGSDFLSFQGISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKPEAWLSCGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQRGTQRGDVLPNADETWYLRATLDVAAGEAAGLSCR

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)