Recombinant Human T-cell surface glycoprotein CD1e, membrane-associated (CD1E), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human T-cell surface glycoprotein CD1e, membrane-associated (CD1E), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008900
• Supplier Catalog Number: orb3008900
• Alternative Catalog Number: BYT-ORB3008900-1, BYT-ORB3008900-100, BYT-ORB3008900-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: T-cell surface glycoprotein CD1e, membrane-associated, hCD1e, R2G1, CD antigen CD1e, [Cleaved into: T-cell surface glycoprotein CD1e, soluble, sCD1e] CD1E

Product Description

This Recombinant Human T-cell surface glycoprotein CD1e, membrane-associated (CD1E), partial, Biotinylated spans the amino acid sequence from region 32-304. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P15812
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: EEQLSFRMLQTSSFANHSWAHSEGSGWLGDLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNMAYQGSDFLSFQGISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKPEAWLSCGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQRGTQRGDVLPNADETWYLRATLDVAAGEAAGLSCR

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)