Recombinant Human Small nuclear ribonucleoprotein-associated proteins B and B (RSMB), Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Small nuclear ribonucleoprotein-associated proteins B and B (RSMB), Biotinylated
• Artikelnummer: BYT-ORB3008901
• Hersteller Artikelnummer: orb3008901
• Alternativnummer: BYT-ORB3008901-1, BYT-ORB3008901-100, BYT-ORB3008901-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Small nuclear ribonucleoprotein-associated proteins B and B, snRNP-B, Sm protein B/B, Sm-B/B, SmB/B, SNRPB COD SNRPB1

Produktbeschreibung

This Recombinant Human Small nuclear ribonucleoprotein-associated proteins B and B (RSMB), Biotinylated spans the amino acid sequence from region 1-240. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: P14678
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)