Recombinant Human Small nuclear ribonucleoprotein-associated proteins B and B (RSMB), Biotinylated

Product Overview

• Article Name: Recombinant Human Small nuclear ribonucleoprotein-associated proteins B and B (RSMB), Biotinylated
• Biozol Catalog Number: BYT-ORB3008901
• Supplier Catalog Number: orb3008901
• Alternative Catalog Number: BYT-ORB3008901-1, BYT-ORB3008901-100, BYT-ORB3008901-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Small nuclear ribonucleoprotein-associated proteins B and B, snRNP-B, Sm protein B/B, Sm-B/B, SmB/B, SNRPB COD SNRPB1

Product Description

This Recombinant Human Small nuclear ribonucleoprotein-associated proteins B and B (RSMB), Biotinylated spans the amino acid sequence from region 1-240. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P14678
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)